PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G15060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 394aa    MW: 42692.6 Da    PI: 7.0211
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G15060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-09243300562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  OPUNC10G15060.1 243 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 300
                      999******************************************9999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-16239303IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565241304IPR004827Basic-leucine zipper domain
PfamPF001703.5E-9243301IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-9243298No hitNo description
SuperFamilySSF579591.34E-10243293No hitNo description
CDDcd147039.08E-22244293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MNTTSTNELM MHRHVQAASY AAAPMPPQQG GKQRAPGLPP TPPPPAAVNS HSSHGDVCMD  60
DTARGLLPPR KAHRRSRSDV PFGYFQPLPP PSPKMEAGGW ALPGCGGAGD DLLNAYMSLE  120
GMGGADGLNN SDGDSRGSSM RTNGADSSEN ESEDYVGADS QALLWGGGEA AGKKRRNNAA  180
GETAARHARS LSMDSLMGKL SFAANGEPAK FSLEFGSGEF TPAEMKRIMA DEKLAEMALA  240
DPKRVKRVLA NRQSAARSKE RRMRYIAELE QKVQILQTEA TTLSAQLTLL QRDSSGMATQ  300
NNELKFRLQS MEQQAQLRDA LNEALTAEVQ RLKLAANEVG DTSSSSNLAH QIQLRCQNQM  360
LDLHKQQQQQ GEQIPFYQLE QPEQNGAARN HESK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086070.0AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A0E0MA280.0A0A0E0MA28_ORYPU; Uncharacterized protein
STRINGLOC_Os10g38820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-69bZIP family protein